PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03315.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 363aa    MW: 41620.2 Da    PI: 9.0361
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03315.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.49.9e-1177112338
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeL 38 
                              ++k  rr+++NReAAr+sR+RKka++++Le+   +L
  Rsa1.0_03315.1_g00001.1  77 PDKTRRRLAQNREAARKSRLRKKAYVQQLETSRLKL 112
                              58999*************************865444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.1E-774121No hitNo description
SMARTSM003381.0E-475133IPR004827Basic-leucine zipper domain
PfamPF001707.1E-877108IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.82977121IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.07E-779119No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
PfamPF141449.7E-30165240IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNTTSTHVVP PRRFEIYETT TLSQVSMWEE SFKNNGGIYT PNSIVIPTNG KPDSLSEDTS  60
NGTPHKFDQE ASTSRHPDKT RRRLAQNREA ARKSRLRKKA YVQQLETSRL KLIHLEQELN  120
RARQQGFYEG NRVDTNALGF SDKMSSGIVA FEMEYGHWVQ EQNRQITELR TVLHGQVSDV  180
ELRLLVDNAM KHYFQLFRMK SAAAKIDVFY IMSGMWKTSA ERFFLWIGGF RPSELLKVLL  240
PHFDPLMDQQ VLDVCNLRQS CQQAEDAVSQ GMEKLQHTLA DSVAAGNLGE GSYIPQITCA  300
MERLEALVSF VNQADHLRHE TLQQMHRILT TRQAARGLLA LGEYFQRLRA LSSSWATRQR  360
EPT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530850.0AK353085.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-10-F22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013678640.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_013678633.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_013678625.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_013678618.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_009125332.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_009125331.10.0PREDICTED: transcription factor TGA4 isoform X1
SwissprotQ391620.0TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A078D9M40.0A0A078D9M4_BRANA; BnaA02g00310D protein
TrEMBLM4EII90.0M4EII9_BRARP; Uncharacterized protein
STRINGBra028604.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.20.0TGACG motif-binding factor 4